Transcript | Ll_transcript_96874 |
---|---|
CDS coordinates | 3-620 (+) |
Peptide sequence | ESKITRKFVCIVPFHFRRYTYSIPLLIIQTVSMAFSISASSTLVSLNYQRSTLFAPTSSSSTKLSSFSSLQFPVHTQLLHISSSSSLRPRILPLVVEAKKQSFSTFDELLDNADKPVLVDFYATWCGPCQFMVPILNEVSTRLNDKIQVVKIDTEKYPSIATKYDIQALPTFIIFKDGEPYDRFEGAMTADQLIERIETTLKVKQ* |
ORF Type | 5prime_partial |
Blastp | Thioredoxin Y1, chloroplastic from Arabidopsis with 63.91% of identity |
---|---|
Blastx | Thioredoxin Y1, chloroplastic from Arabidopsis with 79.82% of identity |
Eggnog | Thioredoxin(COG0526) |
Kegg | Link to kegg annotations (AT1G76760) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427791.1) |
Pfam | Thioredoxin (PF00085.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer