Transcript | Ll_transcript_96811 |
---|---|
CDS coordinates | 2-1093 (+) |
Peptide sequence | KISPSIFCWFLYDDKIRDQIEKDYDQFSSAILHVYRASNLGFREEYELDEAKSFSRNFLHKFVSAENGDKKQIEHELNIPWFTRLDHLENRMWIEEKEANILWKGKASYNRISYHYNNELLQLAIQNFEFKQSIFKKELEELKRWTEEWGISKMGFGREKTTYCYFAIAASTTFIPYDSYIRMLAAKSGIIITVVDDFFDMIGSFSELEALTYAVGRWDSKGLSSHSKTIFDVLDNLVKEVNDRYLLQEGTTDISSSLQDLWYETFLAWLIEAKWSRNWHTPSMDCYMKTSMTSIATHNLVLPASCFLKPILPKEKLRPIQYESLTKLLMILSRLSNDILSYQVIFTLLCSRVYIFMTNPLIER |
ORF Type | internal |
Blastp | S-linalool synthase from Clarkia with 49.86% of identity |
---|---|
Blastx | S-linalool synthase from Clarkia with 49.86% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (AAC49395) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424904.1) |
Pfam | Terpene synthase, N-terminal domain (PF01397.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer