Protein coding transcript 132366

• Transcript: Ll_transcript_96811
• CDS coordinates: 2-1093 (+)
• Peptide sequence: KISPSIFCWFLYDDKIRDQIEKDYDQFSSAILHVYRASNLGFREEYELDEAKSFSRNFLHKFVSAENGDKKQIEHELNIPWFTRLDHLENRMWIEEKEANILWKGKASYNRISYHYNNELLQLAIQNFEFKQSIFKKELEELKRWTEEWGISKMGFGREKTTYCYFAIAASTTFIPYDSYIRMLAAKSGIIITVVDDFFDMIGSFSELEALTYAVGRWDSKGLSSHSKTIFDVLDNLVKEVNDRYLLQEGTTDISSSLQDLWYETFLAWLIEAKWSRNWHTPSMDCYMKTSMTSIATHNLVLPASCFLKPILPKEKLRPIQYESLTKLLMILSRLSNDILSYQVIFTLLCSRVYIFMTNPLIER
• ORF Type: internal

Annotations of Ll_transcript_96811

• Blastp: S-linalool synthase from Clarkia with 49.86% of identity
• Blastx: S-linalool synthase from Clarkia with 49.86% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAC49395)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424904.1)
• Pfam: Terpene synthase, N-terminal domain (PF01397.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;