Protein coding transcript 132375

• Transcript: Ll_transcript_96870
• CDS coordinates: 1-768 (+)
• Peptide sequence: DILSQQHLNNMKWSVAILLLFAGACWAEINLQNLPNIPEIDDIAVVKERCDTKGGPGTYDNVKKSIEEMKTCIKGIINIESIKTEVEESKKTGSMDEVFGKYCKKRPEVKACLQKGIDAVKPCLEDTEKEAMNKTLNVIRELGEFICFRDGDRIAMFVAEGGFECIQEHTEGVKNCVNATLKIDPTKFTSLSPNSIPTISIDKSSCDDLSKVQTCVVEELEKCKDSTPANIVDALFRFIKKSACAVEKKHRRSVFK
• ORF Type: internal

Annotations of Ll_transcript_96870

• Blastp: 27 kDa glycoprotein from Bombyx with 31.76% of identity
• Blastx: 27 kDa glycoprotein from Bombyx with 31.76% of identity
• Eggnog: Protein of unknown function (DUF1397)(ENOG4111PQK)
• Kegg: Link to kegg annotations (692422)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003520749.2)
• Pfam: Protein of unknown function (DUF1397) (PF07165.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;