Protein coding transcript 132386

• Transcript: Ll_transcript_96857
• CDS coordinates: 3-596 (+)
• Peptide sequence: GVKSIIDIMWKLKVSESKEKWNIRSVNNHIGRQFWEFDPDLGTEEERAQVEHVRQQFHNNRFIYKHSSDLLMRLQFEREKGLKEMKVGGNNNVKAEKEIEDISEEVVGRRLKRALRALSAVQSEDGFWPGDYGGPLFLLPALVIGLYVTGALNTILHDEHQREMKRYLFTHQNIDGGWGLHIEGCSTMFCTALSYVSL
• ORF Type: internal

Annotations of Ll_transcript_96857

• Blastp: Cycloartenol synthase from Arabidopsis with 57.37% of identity
• Blastx: Cycloartenol synthase from Arabidopsis with 57.37% of identity
• Eggnog: Squalene--hopene cyclase(COG1657)
• Kegg: Link to kegg annotations (AT2G07050)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438760.1)
• Pfam: Squalene-hopene cyclase N-terminal domain (PF13249.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;