Transcript | Ll_transcript_96828 |
---|---|
CDS coordinates | 2-469 (+) |
Peptide sequence | HAKVGAGVDRVRRSVVLCHSVGSSQSPPSLTSRQQWGLSVSRRPLRVAVAVSAVRQRKMSPLYVSVAVLAVFAFAASGVSADKDKFKCKLRTADIPKEWVSMVDPCVKKMRDQVQTELTASMTYLAMAAHFSQDTVNRPGFAAHFFKSASEEREHA |
ORF Type | internal |
Blastp | Ferritin subunit from Stegomyia with 45.76% of identity |
---|---|
Blastx | Ferritin subunit from Stegomyia with 45.76% of identity |
Eggnog | Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis (By similarity)(COG1528) |
Kegg | Link to kegg annotations (AaeL_AAEL007385) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (NP_001238501.2) |
Pfam | Ferritin-like domain (PF00210.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer