Protein coding transcript 132395

• Transcript: Ll_transcript_96829
• CDS coordinates: 2-343 (+)
• Peptide sequence: EEREHAIKLIEYLLMRGQLTKDVGDLIKDPRPKDDVTAWVDGVSALKDALKLEASVTNNIRDIIAVCEDPGESKFNDYHLVDYLTGDFLDEQYKGQRELAGMISTLDKMMHSHG
• ORF Type: internal

Annotations of Ll_transcript_96829

• Blastp: Ferritin subunit from Stegomyia with 52.68% of identity
• Blastx: Ferritin subunit from Stegomyia with 52.68% of identity
• Eggnog: Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis (By similarity)(COG1528)
• Kegg: Link to kegg annotations (AaeL_AAEL007385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017418689.1)
• Pfam: Ferritin-like domain (PF00210.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;