Protein coding transcript 132398

• Transcript: Ll_transcript_96913
• CDS coordinates: 842-1723 (+)
• Peptide sequence: MFEHPARFETLAMDPKKKEEIINDLVKFKAGKDYYAKIGKAWKRGYLLYGPPGTGKSTMIAAIANFMYYDVYDLELTAVKENTDLKKLLIDTTSKSIIVIEDIDCSLDLTGQRKKAKEKSDEEDKPEDSIKKVKDEEEKKGSNVTLSGLLNFIDGIWSACGGERIIIFTTNFVDKLDPALIRRGRMDKHIELSYCGYEAFKVLAKNYLDIESHTLFPIIEKMLGETNVTPADVAENLMPKSIDEDSDSCFNDLIKSLEEAKNKAEEEAKEKVDGENKELKIVKENGELGQEEK*
• ORF Type: complete

Annotations of Ll_transcript_96913

• Blastp: AAA-ATPase At3g28510 from Arabidopsis with 72.62% of identity
• Blastx: AAA-ATPase ASD, mitochondrial from Arabidopsis with 65.94% of identity
• Eggnog: Acts as a processive, ATP-dependent zinc metallopeptidase for both cytoplasmic and membrane proteins. Plays a role in the quality control of integral membrane proteins (By similarity)(COG0465)
• Kegg: Link to kegg annotations (AT3G28510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428765.1)
• Pfam: Holliday junction DNA helicase ruvB N-terminus (PF05496.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;