Protein coding transcript 132405

• Transcript: Ll_transcript_224449
• CDS coordinates: 52-600 (+)
• Peptide sequence: MSTTISCDFSSFESVQHYFLQNDPDNILISTNTYNSFQSPSGSNDLHKSPTCEEEVSTKARVVNVPPTWKHYRGVRRRPWGRFAAEIRDPKKNGARVWLGTYDTEEEAGLAYDRAAFKMRGQKAKLNFPHLVGSDTTSEPMRVVAATKRIVVEPCSDQCLGTNKRKNVMNLLNRLARNRRQVL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_224449

• Blastp: Ethylene-responsive transcription factor 13 from Arabidopsis with 65.31% of identity
• Blastx: Ethylene-responsive transcription factor 13 from Arabidopsis with 65.98% of identity
• Eggnog: Transcription factor(ENOG41116MW)
• Kegg: Link to kegg annotations (AT2G44840)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450211.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;