Transcript | Ll_transcript_224449 |
---|---|
CDS coordinates | 52-600 (+) |
Peptide sequence | MSTTISCDFSSFESVQHYFLQNDPDNILISTNTYNSFQSPSGSNDLHKSPTCEEEVSTKARVVNVPPTWKHYRGVRRRPWGRFAAEIRDPKKNGARVWLGTYDTEEEAGLAYDRAAFKMRGQKAKLNFPHLVGSDTTSEPMRVVAATKRIVVEPCSDQCLGTNKRKNVMNLLNRLARNRRQVL |
ORF Type | 3prime_partial |
Blastp | Ethylene-responsive transcription factor 13 from Arabidopsis with 65.31% of identity |
---|---|
Blastx | Ethylene-responsive transcription factor 13 from Arabidopsis with 65.98% of identity |
Eggnog | Transcription factor(ENOG41116MW) |
Kegg | Link to kegg annotations (AT2G44840) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019450211.1) |
Pfam | AP2 domain (PF00847.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer