Protein coding transcript 132409

• Transcript: Ll_transcript_224471
• CDS coordinates: 3-383 (+)
• Peptide sequence: RGGGRGGFNRFAEQGPPEEVVPLGYFTHACQDDIICKAEMEDVPYFNAPIYFANKQQIGKIDEIFGTYSDYFVSIKLNSEIKSKSFKGADKLYIDPAKLLPLKKFLPQPGGQRGRGGGGGRGRGRGG
• ORF Type: internal

Annotations of Ll_transcript_224471

• Blastp: H/ACA ribonucleoprotein complex subunit 1 from Mus with 57.41% of identity
• Blastx: Probable H/ACA ribonucleoprotein complex subunit 1 from Sophophora with 57.83% of identity
• Eggnog: h aca RNA-protein complex component gar1(COG3277)
• Kegg: Link to kegg annotations (68147)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003548749.1)
• Pfam: Gar1/Naf1 RNA binding region (PF04410.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;