Protein coding transcript 132410

• Transcript: Ll_transcript_224561
• CDS coordinates: 1-306 (+)
• Peptide sequence: QQSRIHCTRLAGDKADNWWLRQHPKVLNMKFKKGVKRAEISNAIDNYVNNTVGKDMDRKVFEAMYEEVPVPLSDSERRTWLDKLTGVALASDAFFPFRDNID
• ORF Type: internal

Annotations of Ll_transcript_224561

• Blastp: Bifunctional purine biosynthesis protein PURH from Gallus with 67.65% of identity
• Blastx: Bifunctional purine biosynthesis protein PURH from Gallus with 67.65% of identity
• Eggnog: bifunctional purine biosynthesis protein PURH(COG0138)
• Kegg: Link to kegg annotations (396091)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020239904.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;