Transcript | Ll_transcript_224561 |
---|---|
CDS coordinates | 1-306 (+) |
Peptide sequence | QQSRIHCTRLAGDKADNWWLRQHPKVLNMKFKKGVKRAEISNAIDNYVNNTVGKDMDRKVFEAMYEEVPVPLSDSERRTWLDKLTGVALASDAFFPFRDNID |
ORF Type | internal |
Blastp | Bifunctional purine biosynthesis protein PURH from Gallus with 67.65% of identity |
---|---|
Blastx | Bifunctional purine biosynthesis protein PURH from Gallus with 67.65% of identity |
Eggnog | bifunctional purine biosynthesis protein PURH(COG0138) |
Kegg | Link to kegg annotations (396091) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020239904.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer