Protein coding transcript 132411

• Transcript: Ll_transcript_224562
• CDS coordinates: 29-1099 (+)
• Peptide sequence: MIRIVVCNLYPFVETVSKPDVTIADAVENIDIGGVTLLRAAAKNHARVTIICDPSDYDKVIQEIKTSPNKDTTEQTKQSLALKAFTHTSEYDLAITDYLRKQYSANESQITLRYGMNPHQKPAQIFTNLPNLPLKVVNGSPGFINLCDALNGWQLVKELKEALGLPAATSFKHVSPAGAAVGIPLNNEQAKVCMVDDLIGELTPLALAYARARGADRMSSFGDFVALSDVCDKATARLISREVSDGIIAPGYTADALALLSKKKNGNYCVLQIDPTYAPSPIERKILFGLTLEQQRNNAVINSSLFQNVVTDNKNLPESAQRDLIVATIALKYTQSNSVCYAKDGQVVGIGAGQQSR
• ORF Type: 3prime_partial

Annotations of Ll_transcript_224562

• Blastp: Bifunctional purine biosynthesis protein PURH from Gallus with 72.55% of identity
• Blastx: Bifunctional purine biosynthesis protein PURH from Gallus with 72.1% of identity
• Eggnog: bifunctional purine biosynthesis protein PURH(COG0138)
• Kegg: Link to kegg annotations (396091)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464144.1)
• Pfam: MGS-like domain (PF02142.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;