Protein coding transcript 132412

• Transcript: Ll_transcript_224463
• CDS coordinates: 170-1297 (+)
• Peptide sequence: MTTRIAPGVGANLLGQHSAERNQDATAYVGNLDPQISEELLWELFVQAGPVVNVYVPKDRVTNQHQGYGFVEFRSEEDADYAIKVLNMIKLYGKPIRVNKASQDKKSLDVGANLFIGNLDPDVDEKLLYDTFSAFGVIVTNPKIMRDPETGNSRGFGFISYDSFEASDSAIEAMNGQYLCNRQITVSYAYKKDTKGERHGTPAERVLAASNPTAQKSRPHTLFASGPPTLPNAPQANGTIAAPVPPRPFANGIAPPPIPALRPPPPQAATFQPMPVAGPPAWHQQQPGQMPHGMPPPPQMQQFRPPHPGMPMPPPPQGVPAPQRPLPPPSVMANQQPPVWRPPPPPQQQGGLPYGYPQSSMPPPPNNPHMPPPSS*
• ORF Type: complete

Annotations of Ll_transcript_224463

• Blastp: Splicing factor 3B subunit 4 from Homo with 77.56% of identity
• Blastx: Splicing factor 3B subunit 4 from Homo with 77.56% of identity
• Eggnog: Splicing factor 3B subunit 4(ENOG410XPT4)
• Kegg: Link to kegg annotations (10262)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450325.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;