Protein coding transcript 132413

• Transcript: Ll_transcript_224464
• CDS coordinates: 919-1527 (+)
• Peptide sequence: MNGQYLCNRQITVSYAYKKDTKGERHGTPAERVLAASNPTAQKSRPHTLFASGPPTLPNAPQANGTIAAPVPPRPFANGIAPPPIPALRPPPPQAATFQPMPVAGPPAWHQQQPGQMPHGMPPPPQMQQFRPPHPGMPMPPPPQGVPAPQRPLPPPSVMANQQPPVWRPPPPPQQQGGLPYGYPQSSMPPPPNNPHMPPPSS*
• ORF Type: complete

Annotations of Ll_transcript_224464

• Blastp: Splicing factor 3B subunit 4 from Caenorhabditis with 53.76% of identity
• Blastx: Splicing factor 3B subunit 4 from Homo with 77.42% of identity
• Eggnog: Splicing factor 3B subunit 4(ENOG410XPT4)
• Kegg: Link to kegg annotations (CELE_C08B11.5)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014519696.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;