Transcript | Ll_transcript_224536 |
---|---|
CDS coordinates | 2-310 (+) |
Peptide sequence | AMEPYLSHNILSSAPTPTTPFPKSQQKKHEFIKEEEKVIWFITGILASENHVRAEKEEEEENESKVLVTLLEQRVFSCNYCHRKFYSSEALGGHQNAHIRER* |
ORF Type | 5prime_partial |
Blastp | Zinc finger protein 1 from Arabidopsis with 81.82% of identity |
---|---|
Blastx | Zinc finger protein 3 from Arabidopsis with 45.19% of identity |
Eggnog | zinc finger protein(ENOG410YPEB) |
Kegg | Link to kegg annotations (AT1G80730) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438785.1) |
Pfam | C2H2-type zinc finger (PF13912.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer