| Transcript | Ll_transcript_224536 |
|---|---|
| CDS coordinates | 2-310 (+) |
| Peptide sequence | AMEPYLSHNILSSAPTPTTPFPKSQQKKHEFIKEEEKVIWFITGILASENHVRAEKEEEEENESKVLVTLLEQRVFSCNYCHRKFYSSEALGGHQNAHIRER* |
| ORF Type | 5prime_partial |
| Blastp | Zinc finger protein 1 from Arabidopsis with 81.82% of identity |
|---|---|
| Blastx | Zinc finger protein 3 from Arabidopsis with 45.19% of identity |
| Eggnog | zinc finger protein(ENOG410YPEB) |
| Kegg | Link to kegg annotations (AT1G80730) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019438785.1) |
| Pfam | C2H2-type zinc finger (PF13912.5) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer