Protein coding transcript 132422

• Transcript: Ll_transcript_224513
• CDS coordinates: 3-581 (+)
• Peptide sequence: FFYTCRRYWTSGGSIRNVPVGGGSRKNKKVITSYSSSSSPLSKVSDLNPISFRNPKIMEVGHDLSLAFPSMKNYHHEMSSYVGMPKLEVGNPDYHGMAYKGLNNPYVSNSLYLSNGFPMQEIKPNLGFSIDGLGNRSYTNNGVQDNSGKILFPFGDMKQHSNLGVQVELNKEQGNNSSSGYWNEMVDEGSSW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_224513

• Blastp: Dof zinc finger protein DOF3.7 from Arabidopsis with 39.81% of identity
• Blastx: Dof zinc finger protein DOF3.7 from Arabidopsis with 39.35% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G61850)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419453.1)
• Pfam: Dof domain, zinc finger (PF02701.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;