Protein coding transcript 132432

• Transcript: Ll_transcript_224494
• CDS coordinates: 64-459 (+)
• Peptide sequence: MAHLNLFVVLVASLVCFTLAEEKYTTKFDNFDVDKVLNNDRILTSYIKCLLDQGNCTNEGRELKKVLPDALKTDCSKCTAVQKDRSEKVIKFLIKNRSKDFDNLTAKYDPSGEYKKKIEKFDAERAAAAKH*
• ORF Type: complete

Annotations of Ll_transcript_224494

• Blastp: Ejaculatory bulb-specific protein 3 from Sophophora with 55.67% of identity
• Blastx: Ejaculatory bulb-specific protein 3 from Sophophora with 55.67% of identity
• Eggnog: protein serine threonine kinase(ENOG4111U5H)
• Kegg: Link to kegg annotations (Dmel_CG11390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003630003.1)
• Pfam: Insect pheromone-binding family, A10/OS-D (PF03392.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;