Protein coding transcript 132436

• Transcript: Ll_transcript_224568
• CDS coordinates: 54-578 (+)
• Peptide sequence: MEEGMSGFSNRSGSFFGKSGSTGTKCGRWNPTTEQLKLLTELFRSGLRTPSTDQIQKISDQLSFYGKIESKNVFYWFQNHKARERQKRHKVSFDDNSRENTIDDPTKSFAGMYKVPEVDRVTETLQLFPLNSFDESESEMFRVHANECRDNMMFSYTMGGQVEHPPLDLRLSFL*
• ORF Type: complete

Annotations of Ll_transcript_224568

• Blastp: WUSCHEL-related homeobox 5 from Arabidopsis with 54.55% of identity
• Blastx: WUSCHEL-related homeobox 5 from Arabidopsis with 54.04% of identity
• Eggnog: homeobox(ENOG410YNZ0)
• Kegg: Link to kegg annotations (AT3G11260)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433499.1)
• Pfam: Homeobox domain (PF00046.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;