Protein coding transcript 132475

• Transcript: Ll_transcript_174980
• CDS coordinates: 1-315 (+)
• Peptide sequence: PRPLVPNVVEIGGIHIGKAKKVPKNIEKWIDGSSDGVIYFSLGSMIKGHTFPTDKRKEFLKAFGKLSQTVLWKWENETMEGKPDNVMIQKWMPQFDILCHPNVKA
• ORF Type: internal

Annotations of Ll_transcript_174980

• Blastp: UDP-glucuronosyltransferase from Pleuronectes with 42.59% of identity
• Blastx: UDP-glucuronosyltransferase from Pleuronectes with 42.59% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013470035.1)
• Pfam: UDP-glucoronosyl and UDP-glucosyl transferase (PF00201.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;