Protein coding transcript 132484

• Transcript: Ll_transcript_175035
• CDS coordinates: 2-394 (+)
• Peptide sequence: LDNEIKSEEQTSDKSHLPKTFEGFKVSADGAEVELTKETSDETIAIKFNINHSVTEEETEGVDKVALRSKPDFEIDITRGDVVLGFNCSYANNFENTELDESNDEVFHIDEVTIYENKYSDNKYALAGDTL
• ORF Type: internal

Annotations of Ll_transcript_175035

• Blastp: Complement component 1 Q subcomponent-binding protein, mitochondrial from Chlorocebus with 31.08% of identity
• Blastx: Complement component 1 Q subcomponent-binding protein, mitochondrial from Chlorocebus with 31.08% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014629328.1)
• Pfam: Mitochondrial glycoprotein (PF02330.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;