Protein coding transcript 1325

• Transcript: Ll_transcript_444645
• CDS coordinates: 2-298 (+)
• Peptide sequence: GEMHHSSFWPADGVPTKGKRVAVIGTGSTGIQLAQEAAKDAKSVTVFQRTPNLCLPMRQRKLTKEEQDEDKKTRAELYKYRMTTFAGFGYDFAEKNTFD
• ORF Type: internal

Annotations of Ll_transcript_444645

• Blastp: Cyclopentanone 1,2-monooxygenase from Comamonas with 53.12% of identity
• Blastx: Cyclopentanone 1,2-monooxygenase from Comamonas with 53.12% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_012570650.1)
• Pfam: Pyridine nucleotide-disulphide oxidoreductase (PF07992.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;