Protein coding transcript 132511

• Transcript: Ll_transcript_175006
• CDS coordinates: 135-782 (+)
• Peptide sequence: MPNLDELLEGTPTHIFTSVWFEWRKTKLYSTHYSELVRLAALYMYGGIYLDSDIIVLKPISALNNSVGMEDHVAGSALNGAVMAFERHSPFIMECLEEFYATYDDTKLRWSGADLLTRVAKKFLGEEINSMKQLKLKVEPSYIFFPISSGNITRYFIAPATKTEKAEQEVLLEKIVQESLTFHFWNSLTSSLIPEPDSLVAKLMNHACIRCLELL*
• ORF Type: complete

Annotations of Ll_transcript_175006

• Blastp: Uncharacterized protein At4g19900 from Arabidopsis with 65.12% of identity
• Blastx: Uncharacterized protein At4g19900 from Arabidopsis with 61.79% of identity
• Eggnog: lactosylceramide(ENOG4111PD8)
• Kegg: Link to kegg annotations (AT4G19900)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019423742.1)
• Pfam: Glycosyltransferase sugar-binding region containing DXD motif (PF04488.14)
• Rfam: -
• GO: -