Protein coding transcript 1326

• Transcript: Ll_transcript_444628
• CDS coordinates: 70-1389 (+)
• Peptide sequence: MSYSWCSLFLAHIILIHFTIFSLASSSDNTYNLFETWCKQHNKTFSSEQEKQYKFKVFQDNYAFVTQHNNRVGNSSYTLSLNAFADLTHHEFRTSRIRGLSPRLFRFNHSQNQQSRNRVLHLPSEFDWRKNGAVTPVKDQGSCGACWSFSATGAIEGINKIVTGSLVSLSEQELVDCDRNYNSGCEGGLMDYAYQFVIDNHGIDTEKDYPYQAHDRTCSKDKLKRRVVTIDGYTDVPQGDEKKLLEAVASQPVSVGICGSDRAFQLYSKGIFSGPCSTDLDHAVLIVGYGSENGVDYWIVKNSWGTSWGMNGYMHMVRNSGNSEGLCGINTLASYPIKTKPNPPTPSPPSPTRCSLFTYCSEGETCCCAKSFLGICLSYKCCGVTSAVCCKDKRHCCPHDYPVCDTARGQCLKRVANGTVTKAFEDEGTFGTPRGWNSQ*
• ORF Type: complete

Annotations of Ll_transcript_444628

• Blastp: Probable cysteine protease RD21C from Arabidopsis with 47.38% of identity
• Blastx: Probable cysteine protease RD21C from Arabidopsis with 47.38% of identity
• Eggnog: cathepsin(COG4870)
• Kegg: Link to kegg annotations (AT3G19390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438032.1)
• Pfam: Cathepsin propeptide inhibitor domain (I29) (PF08246.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;