Transcript | Ll_transcript_400938 |
---|---|
CDS coordinates | 826-1239 (+) |
Peptide sequence | MNDENVIAEYKELEKNMNKDKIFKLAKGFRGRAKNCIRIARERVEKALQYSYRDRRNKKRDMRSLWIQRINAGTRLHGVNYGNFMHGLTKENIQLNRKVLSELSMHEPYSFKALVDISQKAFPGNKNVVIPPRKVNL* |
ORF Type | complete |
Blastp | 50S ribosomal protein L20 from Rhodospirillum with 64.42% of identity |
---|---|
Blastx | 50S ribosomal protein L20 from Rhodospirillum with 64.42% of identity |
Eggnog | Binds directly to 23S ribosomal RNA and is necessary for the in vitro assembly process of the 50S ribosomal subunit. It is not involved in the protein synthesizing functions of that subunit (By similarity)(COG0292) |
Kegg | Link to kegg annotations (RC1_2313) |
CantataDB | Link to cantataDB annotations (CNT0001777) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019459247.1) |
Pfam | Ribosomal protein L20 (PF00453.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer