Transcript | Ll_transcript_153269 |
---|---|
CDS coordinates | 1-372 (+) |
Peptide sequence | ALSRTRSKKSNNVVAHGAYSTFKVDVYAFGVILLELLTGKVVQENSGFDLAQWVNSVVREEWTVEVFDKHLISQGASEERMVNMLQVAFKCINPSPDARPSMVEVAAMTISLKEEDDRSSITF* |
ORF Type | 5prime_partial |
Blastp | Probable inactive receptor kinase At3g08680 from Arabidopsis with 56.99% of identity |
---|---|
Blastx | Probable inactive receptor kinase At3g08680 from Arabidopsis with 56.99% of identity |
Eggnog | Leucine rich repeat N-terminal domain(ENOG411040X) |
Kegg | Link to kegg annotations (AT3G08680) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464741.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer