Protein coding transcript 132668

• Transcript: Ll_transcript_153269
• CDS coordinates: 1-372 (+)
• Peptide sequence: ALSRTRSKKSNNVVAHGAYSTFKVDVYAFGVILLELLTGKVVQENSGFDLAQWVNSVVREEWTVEVFDKHLISQGASEERMVNMLQVAFKCINPSPDARPSMVEVAAMTISLKEEDDRSSITF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_153269

• Blastp: Probable inactive receptor kinase At3g08680 from Arabidopsis with 56.99% of identity
• Blastx: Probable inactive receptor kinase At3g08680 from Arabidopsis with 56.99% of identity
• Eggnog: Leucine rich repeat N-terminal domain(ENOG411040X)
• Kegg: Link to kegg annotations (AT3G08680)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464741.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;