Protein coding transcript 1328

• Transcript: Ll_transcript_301282
• CDS coordinates: 3-734 (+)
• Peptide sequence: KSLSLPTIPRAISISVPDTRVAIPAPPSIDIDDSITAFWDYQFLFVSQRYETTQPINLRIVDGTIPADFPSGTYYLTGPGLFADDHGSTVHPLDGHGYLRAFTIDNVTKKVKYMAKYIKTEAQVEEHDPKTNTWRFTHRGPFSVLKGGRKVGNTKVMKNVANTSVLRWGEKLLCMWEGGDPYEIESHTLDTVGQYNMIDGNNLEGYDKKYDVDIWEVAARLLKPLLYGVFKMPPRRLLSHYKVD
• ORF Type: internal

Annotations of Ll_transcript_301282

• Blastp: Carotenoid cleavage dioxygenase 7, chloroplastic from Arabidopsis with 63.33% of identity
• Blastx: Carotenoid cleavage dioxygenase 7, chloroplastic from Arabidopsis with 63.33% of identity
• Eggnog: dioxygenase(COG3670)
• Kegg: Link to kegg annotations (AT2G44990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433092.1)
• Pfam: Retinal pigment epithelial membrane protein (PF03055.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;