Protein coding transcript 132808

• Transcript: Ll_transcript_147761
• CDS coordinates: 1-912 (+)
• Peptide sequence: NNMQSNHQLVSDENEGNNNHRNNNHSFPLTTTTTASPDTSSLPHDISLDRIGLCNSSLNFMHHHQFNYNNQGSFLHDNNQTNNNDECMNMNDHAQDMQQYFEPLDTKDHKQGQKGSDSMSDCSDQNEEEDDGKYRRRNGKGNQSKNLVAERKRRKKLNDRLYNLRSLVPRISKLDRASILGDAIEYVKDLQKQVKELQDELEENSDTGADSNCFNNNNHVVGVKQTDNLNGAEIGPKEPEHCKTKNGFHVGTSGNGYITKQKQEVDASTMDKQTQQMEPQVEVAHIDGNEYFVKVFSEHRLGGF
• ORF Type: internal

Annotations of Ll_transcript_147761

• Blastp: Transcription factor ABORTED MICROSPORES from Arabidopsis with 55.32% of identity
• Blastx: Transcription factor ABORTED MICROSPORES from Arabidopsis with 55.32% of identity
• Eggnog: transcription factor ABORTED(ENOG410YFZF)
• Kegg: Link to kegg annotations (AT2G16910)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432464.1)
• Pfam: Helix-loop-helix DNA-binding domain (PF00010.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;