Transcript | Ll_transcript_147693 |
---|---|
CDS coordinates | 1185-1844 (+) |
Peptide sequence | MFYTFIRLAPEHPIPAAYEDSWAALQWVASHKNNTGPEAWLNEHADFERVFLGGESSGANIVHNIAMVAGHPDLELGIEILGACLVHPYFWGSEPIGSEALTPDQNRKAMLDKLWPFVCPSMPDNDDPRVNPVAEGAPSLARLCCKRMLVCVAEKDVLRDRGWLYYNALGRSGWPGVVQIEETLGEGHAFHLYNLGCNKAQDFIKRLAEFYNRDMPPEV* |
ORF Type | complete |
Blastp | 2-hydroxyisoflavanone dehydratase from Soja with 49.76% of identity |
---|---|
Blastx | 2-hydroxyisoflavanone dehydratase from Soja with 49.76% of identity |
Eggnog | alpha beta hydrolase fold-3 domain protein(COG0657) |
Kegg | Link to kegg annotations (547489) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019457465.1) |
Pfam | alpha/beta hydrolase fold (PF07859.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer