Protein coding transcript 132961

• Transcript: Ll_transcript_96037
• CDS coordinates: 2-379 (+)
• Peptide sequence: RVKSVNNPDKRVQIIKEFVLEHFPATPLLHYALEVEKLTTSKKPNLILNVDGVIAVSFVDLLRHSGCFTREEAQEYVEMGSINSLFVLGRSIGFIGHYMDQKRLKQGLYRHPWDDISYILPEQYN*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_96037

• Blastp: ATP-citrate synthase from Bos with 76.8% of identity
• Blastx: ATP-citrate synthase from Bos with 78.69% of identity
• Eggnog: Succinyl-CoA synthetase subunit beta(COG0045)
• Kegg: Link to kegg annotations (511135)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003550659.1)
• Pfam: Citrate synthase, C-terminal domain (PF00285.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;