Protein coding transcript 133

• Transcript: Ll_transcript_458895
• CDS coordinates: 2-607 (+)
• Peptide sequence: MAFKEGAGLFPMDKNGKMLFSDADYLDTWKAMEELKKMGLVKSIGVSNFNSEQLDRLLAVAKIKPVTNQIEVHPCLNQSKLISYCKERDILVTAYSPFASPDRPWAKPTDPSLLDDPTIKAIGDKYKKSNAQVILRYLIQRGTVPIPKSVTPSRIQANFDIFDFELKPEDIKIMDGLDCNGRICAFDEAKESKDWPFNIEF*
• ORF Type: complete

Annotations of Ll_transcript_458895

• Blastp: Aldose reductase from Oryctolagus with 56.93% of identity
• Blastx: Aldose reductase from Oryctolagus with 56.93% of identity
• Eggnog: reductase(COG0656)
• Kegg: Link to kegg annotations (100009122)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_015951940.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;