Transcript | Ll_transcript_45360 |
---|---|
CDS coordinates | 70-717 (+) |
Peptide sequence | MASSASEEEVTLTVKWSGKEYTVRVCGDDTVGELKRRICELTNVLPIRQKLLYPKAGSKLNDDSLFLSQLPLKSSFKMTMIGTTEEDLIVDPVESPEIVDDFELGKEETVDIKDMEVNKQKLIRRISQFKIEVQNPCRKGKKLLVLDIDYTLFDHRSTAENPLQLMRPCNHHLYHCAYFLLASLLSVIFCLFRSLYFLVQTFTSFLHQFIQSMTL* |
ORF Type | complete |
Blastp | Ubiquitin-like domain-containing CTD phosphatase from Arabidopsis with 74.43% of identity |
---|---|
Blastx | Ubiquitin-like domain-containing CTD phosphatase from Arabidopsis with 78.21% of identity |
Eggnog | CTD (Carboxy-terminal domain, RNA polymerase II, polypeptide A)(COG5190) |
Kegg | Link to kegg annotations (AT4G06599) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464724.1) |
Pfam | Ubiquitin family (PF00240.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer