Protein coding transcript 133391

• Transcript: Ll_transcript_265426
• CDS coordinates: 3-431 (+)
• Peptide sequence: WLFNLVAEEWSSWLPESALETIRDGGYYTVSPRPGFRIIVLNSNVCFTLNWWLIYDDFDPYNQLSWLAKTLLESEQNGESVHILSHVPSGDGSCLQVWSREFNKIVQRFANTITGHFNGHTHMDEFQVFFNQSNPSEAVNVAY
• ORF Type: internal

Annotations of Ll_transcript_265426

• Blastp: Sphingomyelin phosphodiesterase from Bos with 46.85% of identity
• Blastx: Sphingomyelin phosphodiesterase from Bos with 46.85% of identity
• Eggnog: Sphingomyelin phosphodiesterase(ENOG410YYPB)
• Kegg: Link to kegg annotations (505097)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_016187648.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;