Protein coding transcript 133392

• Transcript: Ll_transcript_265427
• CDS coordinates: 3-323 (+)
• Peptide sequence: GKNVACEDALCCQSDSDDPKDSSDACGYWTEYKNADIPWHTVEELLKQVKNHDFDFVYFTGDIISHRVWSTSIESNTQAIKEVISYLETNFRCQFFQFWVIMNLHL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_265427

• Blastp: Sphingomyelin phosphodiesterase from Bos with 37.08% of identity
• Blastx: Sphingomyelin phosphodiesterase from Homo with 38.37% of identity
• Eggnog: Sphingomyelin phosphodiesterase(ENOG410YYPB)
• Kegg: Link to kegg annotations (505097)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_017406246.1)
• Pfam: Calcineurin-like phosphoesterase (PF00149.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;