Protein coding transcript 1334

• Transcript: Ll_transcript_444615
• CDS coordinates: 46-501 (+)
• Peptide sequence: MLLLCVISCIALVLDPLIIVERKLCVEAMGISSQPSLVSISLTNLLEGSEEHRKSSSYEYLWNKVLEGGKVRKKSVQYKRPRRTLMKRRVGSRRGVKGIQRKVRTLKRLVPNSESLELDGLFRETTDYILALQTRVRIMQVMVNVLKGSDE*
• ORF Type: complete

Annotations of Ll_transcript_444615

• Blastp: Transcription factor UPBEAT1 from Arabidopsis with 51.39% of identity
• Blastx: Transcription factor UPBEAT1 from Arabidopsis with 58.49% of identity
• Eggnog: Transcription factor(ENOG4111CN7)
• Kegg: Link to kegg annotations (AT2G47270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427947.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;