Transcript | Ll_transcript_265391 |
---|---|
CDS coordinates | 161-961 (+) |
Peptide sequence | MGTKSLCYVFLLYAFLVQFNLHNCAIVSQDIARSESEALEQAGSKRETLEIIIGGGSYTPAPSPQCPPPPPPPCPPPPQPLSRLDKARLVLLNFTKFIDDPKGYTKNWNQNTINTCKFNGIRCAPYPNTTEQAVAGIDLNQAGISCLNKTPLSLYGILDRIPELTFFHVNSNNFSGGIPNQITKFPFFFELDVSNNKLVGEFPKEVLQAMQLVFLDLRFNYLYGSLPPQLFQLPLDFIFINNNKFSQCLPDNFGSTPARYSTMDIP* |
ORF Type | complete |
Blastp | Leucine-rich repeat extensin-like protein 1 from Arabidopsis with 41.01% of identity |
---|---|
Blastx | Uncharacterized protein At4g06744 from Arabidopsis with 57.99% of identity |
Eggnog | Leucine-rich repeat(ENOG411157W) |
Kegg | Link to kegg annotations (AT1G12040) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445810.1) |
Pfam | Leucine rich repeat N-terminal domain (PF08263.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer