Transcript | Ll_transcript_175407 |
---|---|
CDS coordinates | 237-830 (+) |
Peptide sequence | MTISHNTLAFAFGMLGNVISFMVFLAPMVTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALLKKGAFLLITINSFGAVVEFIYIIFFITFADTDARKLTIKLFSAMNVGSFALILLVTRFAMHDGALRVKVVGWICVSISISVFAAPLSIVRQVVRTKSVEYMPFNLSFTLTLSAIMWFGYGLFLKDICIAVSIY* |
ORF Type | complete |
Blastp | Bidirectional sugar transporter N3 from Medicago with 83.33% of identity |
---|---|
Blastx | Bidirectional sugar transporter N3 from Medicago with 83.33% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019429554.1) |
Pfam | Sugar efflux transporter for intercellular exchange (PF03083.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer