Protein coding transcript 133434

• Transcript: Ll_transcript_175407
• CDS coordinates: 237-830 (+)
• Peptide sequence: MTISHNTLAFAFGMLGNVISFMVFLAPMVTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALLKKGAFLLITINSFGAVVEFIYIIFFITFADTDARKLTIKLFSAMNVGSFALILLVTRFAMHDGALRVKVVGWICVSISISVFAAPLSIVRQVVRTKSVEYMPFNLSFTLTLSAIMWFGYGLFLKDICIAVSIY*
• ORF Type: complete

Annotations of Ll_transcript_175407

• Blastp: Bidirectional sugar transporter N3 from Medicago with 83.33% of identity
• Blastx: Bidirectional sugar transporter N3 from Medicago with 83.33% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429554.1)
• Pfam: Sugar efflux transporter for intercellular exchange (PF03083.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;