Protein coding transcript 133500

• Transcript: Ll_transcript_40625
• CDS coordinates: 285-794 (+)
• Peptide sequence: MSAYGHQMEQMYSSRSLSGGSEIPSNYVMESGFHIPSLAATILVSALVAVGVLLITLLISLAIMLQSCQSRNAGVFDHPNTNDYSYCKVYSLHAELNNLEGYQIPDICRDLGIQYIKGGQYGKDLDVMKSMIEDYFNSSRPSDDGLDVVLMDLDGIFPPNPPSFNLFRR*
• ORF Type: complete

Annotations of Ll_transcript_40625

• Blastp: Uncharacterized protein At2g39920 from Arabidopsis with 44.23% of identity
• Blastx: Uncharacterized protein At2g39920 from Arabidopsis with 44.06% of identity
• Eggnog: HAD superfamily, subfamily IIIB (Acid phosphatase)(ENOG411181T)
• Kegg: Link to kegg annotations (AT2G39920)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460878.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;