Protein coding transcript 133556

• Transcript: Ll_transcript_40662
• CDS coordinates: 113-571 (+)
• Peptide sequence: MEKTGEASPPPPPVPRVAVVVFLLKGRSVLLGRRLSSVGHSTFALPGGHLEFGESFEECAAREVKEETGLVIGKVEFLTVINNVMMLKEQKKCHYVTIFMRAVMDEDSKEVAMNLEPDKCDGWDWYEWEQLPHPLFGPLHNMVNQGFNPFPI*
• ORF Type: complete

Annotations of Ll_transcript_40662

• Blastp: Geranyl diphosphate phosphohydrolase from Rosa with 65.44% of identity
• Blastx: Geranyl diphosphate phosphohydrolase from Rosa with 65.12% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AFW17224)
• CantataDB: Link to cantataDB annotations (CNT0002665)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418317.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;