Protein coding transcript 133603

• Transcript: Ll_transcript_260710
• CDS coordinates: 201-698 (+)
• Peptide sequence: MVAFHHAHVVGPNQCCSVVIQHIDAPISAVWSVVRRFDNPQGYKHFVKSCHVVTTDGDDGIRVGAIREVLVISGLPAESSRERLEILDDERHVISFSVVGGDHRLRNYRSLTTLHGDGDGGTIVIESYVVDVPHGNTKEETCVFVDTIVRCNLQSLARKSQVSKH*
• ORF Type: complete

Annotations of Ll_transcript_260710

• Blastp: Abscisic acid receptor PYL5 from Arabidopsis with 68.55% of identity
• Blastx: Abscisic acid receptor PYL5 from Arabidopsis with 67.48% of identity
• Eggnog: abscisic acid receptor(ENOG4111MYF)
• Kegg: Link to kegg annotations (AT5G05440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456748.1)
• Pfam: Polyketide cyclase / dehydrase and lipid transport (PF10604.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;