Protein coding transcript 133616

• Transcript: Ll_transcript_260593
• CDS coordinates: 70-837 (+)
• Peptide sequence: MGRAPCCDKANVKRGPWSPEEDATLKNYLKNHGTGGNWITLPQKAGLKRCGKSCRLRWLNYLRPHIKHGGFTDEEDRVICTLYATIGSRWSLIAAQLQGRTDNDVKNHWNTKLKKKFLAENNNIGTNNTSHMINNIDSPQFSTFTPQPQVEAFLFDHKNSPCYDPYILGLDQTPFPVPLSMPLELDVSGYETSMSNNCGIIPFSKEEKDNNNTQQWLGYEDGDAAMLLDFVYEDFLHNNGFVSQDKSSQIASSSI*
• ORF Type: complete

Annotations of Ll_transcript_260593

• Blastp: Transcription factor RAX3 from Arabidopsis with 80.51% of identity
• Blastx: Transcription factor RAX3 from Arabidopsis with 80.51% of identity
• Eggnog: Myblike DNAbinding domain containing protein(COG5147)
• Kegg: Link to kegg annotations (AT3G49690)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446415.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;