Protein coding transcript 133712

• Transcript: Ll_transcript_40581
• CDS coordinates: 87-422 (+)
• Peptide sequence: MKFCSECNNTLYPKEDKEHKILLYGCRNCDHEEVADNNIVYRNKIHHSDSERTQGLQNVAADPTLPRTKSVRCAQCNHGEAVFYQGTAPGEEGMALFFVCCNPNCGNRWRD*
• ORF Type: complete

Annotations of Ll_transcript_40581

• Blastp: DNA-directed RNA polymerases II, IV and V subunit 9A from Arabidopsis with 77.48% of identity
• Blastx: DNA-directed RNA polymerases II, IV and V subunit 9A from Arabidopsis with 76.11% of identity
• Eggnog: DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (By similarity)(COG1594)
• Kegg: Link to kegg annotations (AT3G16980)
• CantataDB: Link to cantataDB annotations (CNT0002206)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429944.1)
• Pfam: RNA polymerases M/15 Kd subunit (PF02150.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;