Protein coding transcript 133764

• Transcript: Ll_transcript_107560
• CDS coordinates: 67-924 (+)
• Peptide sequence: MVTGSINDVVSSIDMEKMLCELLVDTKQPICERFRALFSLRNLKGPAPRDALIRATRDSSNLLAHEAAFALGQMQEIEAIPALASILNDLSLHPIVRHEAAEALGAIGSDSNLPLLENSLDLDPAEEVRETCELALQRIRHFKHAAISHQLSAPDASPFKSVDPAAPATSSLSVHQLRKLLLDEEKGMYARYAALFALRNDGGKEAVAAIIDSLGSKSALLRHEVAYVLGQLQDKVASAALSNILKDVTEHPMVRHEAAEALGSIAGITIYNQIPLKVLFFFKLI*
• ORF Type: complete

Annotations of Ll_transcript_107560

• Blastp: Deoxyhypusine hydroxylase from Arabidopsis with 72.14% of identity
• Blastx: Deoxyhypusine hydroxylase from Arabidopsis with 72.14% of identity
• Eggnog: Catalyzes the hydroxylation of the N(6)-(4-aminobutyl)- L-lysine intermediate to form hypusine, an essential post- translational modification only found in mature eIF-5A factor (By similarity)(COG1413)
• Kegg: Link to kegg annotations (AT3G58180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426176.1)
• Pfam: HEAT repeats (PF13646.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;