Transcript | Ll_transcript_107519 |
---|---|
CDS coordinates | 56-469 (+) |
Peptide sequence | MKRRMCHILMAALIFSSLVCVLNKPLSPFDVNQQELFKPSNTVDQTTRIQDVPTPAFDSTQGDERIKKAKENGYKETLRGLSRLGSTPPRCEHKCGGCIPCDPIQIPTSNKHLLRLQYANYEPEGWKCKCANSYFNP* |
ORF Type | complete |
Blastp | EPIDERMAL PATTERNING FACTOR-like protein 3 from Arabidopsis with 43.21% of identity |
---|---|
Blastx | EPIDERMAL PATTERNING FACTOR-like protein 3 from Arabidopsis with 43.21% of identity |
Eggnog | NA(ENOG410ZBMI) |
Kegg | Link to kegg annotations (AT3G13898) |
CantataDB | Link to cantataDB annotations (CNT0001168) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019416839.1) |
Pfam | Epidermal patterning factor proteins (PF17181.3) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer