Protein coding transcript 133881

• Transcript: Ll_transcript_40260
• CDS coordinates: 1230-1865 (+)
• Peptide sequence: MQLFAYDTVKKQLSPKPGEQPKIPIPESLVAGAVAGVSSTLFTYPLELLKTRITVQRGVYKNLLDALVSIVRDEGPAELYRGLTPSLIGVIPYAATNYLAYDTLRKGYKKAFNKEEVGNVMTLVIGSAAGALSSSATFPLEVARKHMQAGALNGRQYNNMLHALKSILEKEGLAGLYRGLGPSCLKLVPAAGISFMCYEACKRILDENEQS*
• ORF Type: complete

Annotations of Ll_transcript_40260

• Blastp: Adenine nucleotide transporter BT1, chloroplastic/mitochondrial from Arabidopsis with 70.14% of identity
• Blastx: Adenine nucleotide transporter BT1, chloroplastic/mitochondrial from Arabidopsis with 70.14% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: Link to kegg annotations (AT4G32400)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463255.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;