Protein coding transcript 133885

• Transcript: Ll_transcript_116148
• CDS coordinates: 1-321 (-)
• Peptide sequence: GVESSLLDKVKLEIKDLFNLPMSEKKRFWQSCEDFEGFGQTFVVSENQKLDWSDILILFTRPIHMRKPHLFPNFPLPLRDTLELYLEELKNLALTIIGQMAKALGSK
• ORF Type: internal

Annotations of Ll_transcript_116148

• Blastp: Protein SRG1 from Arabidopsis with 59.62% of identity
• Blastx: Protein SRG1 from Arabidopsis with 59.62% of identity
• Eggnog: 2OGFe(II) oxygenase(COG3491)
• Kegg: Link to kegg annotations (AT1G17020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424937.1)
• Pfam: non-haem dioxygenase in morphine synthesis N-terminal (PF14226.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;