Protein coding transcript 1339

• Transcript: Ll_transcript_301277
• CDS coordinates: 15-875 (+)
• Peptide sequence: MWLPTLFFALVACYQCAEGVHLMNWRPKPKISLDATLQKHIVNGSEAPTQYFKYQVGLDIVRDNSISIRCGGALIAEQWVLTAGHCIQMYPDEKFSYANVLLGAHLRDHIDEHRQVIRGEQAFMHPGWSDWYNRDNGNSDIALIKLERPAKLNDYVDTVRLPNEEEKSKDFVNWPGRVSGWGHTEDRTPSSELRYNDVRIVSNEECEEKIESGLFSDANICTSGEEGKGLGPGDSGGPLVVYGRDGKPFVVGVCSFISGWGKGRPAAYTRVTKYLDWIQDTINNNS*
• ORF Type: complete

Annotations of Ll_transcript_301277

• Blastp: Collagenase from Hypoderma with 35.66% of identity
• Blastx: Collagenase from Hypoderma with 33.47% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (CAA52359)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020963341.1)
• Pfam: Trypsin (PF00089.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;