Transcript | Ll_transcript_458867 |
---|---|
CDS coordinates | 39-434 (+) |
Peptide sequence | MLGLRTATRASQALPAFRNTAARRWASSGAEFKGAADNAFNRERAAVKQHAADTSGTWRKLSIYVVIPSIILAGVNAYRLWTEHWEHVAHGPALEDKPEYPFQNIRTKNYFWGDGDKTLFWNPKVNYHKKE* |
ORF Type | complete |
Blastp | - |
---|---|
Blastx | Cytochrome c oxidase subunit 6A, mitochondrial from Saccharomyces with 45.45% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (YGL191W) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_015957732.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer