Transcript | Ll_transcript_301278 |
---|---|
CDS coordinates | 15-875 (+) |
Peptide sequence | MWLPTLFFALVACYQCAEGVHLMNWRPKPKISLDATLQKHIVNGSEAPTQYFKYQVGLDIVRDNSISIRCGGALIAEQWVLTAGHCIQMYPDEKFSYANVLLGAHLRDHIDEHRQVIRGEQAFMHPGWSDWYNRDNGNSDIALIKLERPAKLNDYVDTVRLPNEEEKSKDFVNWPGRVSGWGHTEDRTPSSELRYNDVRIVSNEECEEKIESGLFSDANICTSGEEGKGLGPGDSGGPLVVYGRDGKPFVVGVCSFISGWGKGRPAAYTRVTKYLDWIQDTINNNS* |
ORF Type | complete |
Blastp | Collagenase from Hypoderma with 35.66% of identity |
---|---|
Blastx | Collagenase from Hypoderma with 33.47% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (CAA52359) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_020963341.1) |
Pfam | Trypsin (PF00089.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer