Transcript | Ll_transcript_400961 |
---|---|
CDS coordinates | 164-769 (+) |
Peptide sequence | MKQVTALQLFRDVANKPRSRLLGLDVGDKYVGLALSDFNNQIASPFSVLVRKKSNIALMASDFECLISQYSLKGFVIGIPFDRHRVSADAVQVKAFINDLSSTKKLQGIPYTYWNERFTSKNVELFLKPLDLYHPYHSKTMLDKFAAVGILQVSSLICFLTQSTIFTVLLIFLMLPIVEKYMSSLFICNCTESIRRKHLGL* |
ORF Type | complete |
Blastp | Probable copper-transporting ATPase HMA5 from Arabidopsis with 65.81% of identity |
---|---|
Blastx | Probable copper-transporting ATPase HMA5 from Arabidopsis with 80.56% of identity |
Eggnog | p-type ATPase(COG2217) |
Kegg | Link to kegg annotations (AT1G63440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420916.1) |
Pfam | haloacid dehalogenase-like hydrolase (PF00702.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer