Protein coding transcript 13403

• Transcript: Ll_transcript_400963
• CDS coordinates: 164-667 (+)
• Peptide sequence: MKQVTALQLFRDVANKPRSRLLGLDVGDKYVGLALSDFNNQIASPFSVLVRKKSNIALMASDFECLISQYSLKGFVIGIPFDRHRVSADAVQVKAFINDLSSTKKLQGIPYTYWNERFTSKNVELFLKPLDLYHPYHSKTMLDKFAAVGILQGYLDYANRKVKLETE*
• ORF Type: complete

Annotations of Ll_transcript_400963

• Blastp: Probable copper-transporting ATPase HMA5 from Arabidopsis with 65.81% of identity
• Blastx: Probable copper-transporting ATPase HMA5 from Arabidopsis with 80.56% of identity
• Eggnog: p-type ATPase(COG2217)
• Kegg: Link to kegg annotations (AT1G63440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420916.1)
• Pfam: haloacid dehalogenase-like hydrolase (PF00702.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;