Protein coding transcript 134093

• Transcript: Ll_transcript_221509
• CDS coordinates: 2-406 (+)
• Peptide sequence: FSQTQPQSDWEQISQTIKNYYIGTDEKISASTYRQLVKLFTDRYFITEAERAAKLQSKAVKSSVYYYLYNYRGTATLSDLDFPNLKPEFKGISHGDDILHLYGEIYQNRQLSESDKQIKETLLDILVSFAGTGTP
• ORF Type: internal

Annotations of Ll_transcript_221509

• Blastp: Venom carboxylesterase-6 from Apis with 29.63% of identity
• Blastx: Venom carboxylesterase-6 from Apis with 29.63% of identity
• Eggnog: Carboxylesterase(COG2272)
• Kegg: Link to kegg annotations (410928)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020967633.1)
• Pfam: Carboxylesterase family (PF00135.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;